PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01019981001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ZF-HD
Protein Properties Length: 215aa    MW: 23393.5 Da    PI: 8.8199
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01019981001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.32.8e-312782359
        ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                       ++ Y +C+kNhAa+ Gg+avDGC+Efm+s geegt +alkCaACgCHRnFHRrev+ 
  GSVIVT01019981001 27 SISYGQCQKNHAAKSGGYAVDGCREFMAS-GEEGTREALKCAACGCHRNFHRREVDA 82
                       679*************************9.999*********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-202383IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.8E-292880IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-253080IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.6433079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MKKCEVVIKG AKEQGKSSSS SSVTLKSISY GQCQKNHAAK SGGYAVDGCR EFMASGEEGT  60
REALKCAACG CHRNFHRREV DADQSYGKMM KMILLMMVIK TTSLLIVVAV AIDIVETIGG  120
GKANYSVMTV VIVVVIAANI SLTKSVLVVV HPNLEHPFAN TNFIAELFNQ TLIALLHLPP  180
QFFREREHLL LLLLTELGAK PLSSIWDVLP RHLV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.68940.0bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4315140.0AM431514.2 Vitis vinifera contig VV78X039809.13, whole genome shotgun sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.14e-28mini zinc finger 2